PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa02164s010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 178aa    MW: 19029.3 Da    PI: 9.8477
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa02164s010.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B341.23.1e-13781225399
                     EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  53 rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     r +++r++lt+GW++Fv+ ++L +gD+vvF+  ++s  e++++v+r+
  Csa02164s010.1  78 RTTPRRHLLTTGWSKFVNNKKLIAGDSVVFM--RKSADEMFIGVRRA 122
                     678899*************************..44788899***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.57E-1078123IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.7E-1278122IPR015300DNA-binding pseudobarrel domain
PfamPF023622.5E-1078122IPR003340B3 DNA binding domain
PROSITE profilePS508638.99583123IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
NSSQPPRFLT RYIGLVPSVS CDTPSNVAAL FASFSMTVTD QPSMADNYQF DLGGSDAKAT  60
PVVDCLRHLS TVSSSSSRTT PRRHLLTTGW SKFVNNKKLI AGDSVVFMRK SADEMFIGVR  120
RAPISSNIGG TSFYGGDEYC SYYQSSGGVA KEDDGSAKKG FRRTGKGKLT AEATALR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0071431e-163AC007143.5 Arabidopsis thaliana chromosome 2 BAC T17H1 genomic sequence, complete sequence.
GenBankAC0077301e-163AC007730.3 Arabidopsis thaliana chromosome 2 BAC T5M2 genomic sequence, complete sequence.
GenBankAK2300141e-163AK230014.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL22-53-A06.
GenBankCP0026851e-163CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBankJF7292001e-163JF729200.1 Arabidopsis thaliana ecotype C24 mitochondrion, complete genome.
GenBankJF7292011e-163JF729201.1 Arabidopsis thaliana ecotype Col-0 mitochondrion, complete genome.
GenBankJF7292021e-163JF729202.1 Arabidopsis thaliana ecotype Landsberg erecta mitochondrion, complete genome.
GenBankY085011e-163Y08501.2 Arabidopsis thaliana mitochondrial genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302016.11e-45hypothetical protein CARUB_v10019991mg, partial
SwissprotQ84WU64e-38ARFQ_ARATH; Auxin response factor 17
TrEMBLR0HYF11e-45R0HYF1_9BRAS; Auxin response factor (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58027130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77850.19e-32auxin response factor 17